Last updated: 2025-05-31 19290 annotations 43 curated publications
Contact curators ...
Gene: SJAG_00161
Gene symbol
(none)
Product
Velum formation protein 1-like conserved fungal family
Feature type
protein coding
Systematic ID
SJAG_00161
Product size
209 aa, 23.43 kDa
Genomic location
I, 3921875-3921246 (630nt) coding start to stop
3921875-3921246 (630nt) including UTRs
Predicted structure
Protein features
Genome browser
Hide all
Structure view loading ...
Protein domains and features
Protein families and domains
Match ID Source Name InterPro ID Start End Count
PF10339 Pfam Velum formation protein 1-like IPR019435
7
209
Domain organization at InterPro ...
No predicted trans-membrane domains
Protein sequence features
  Term ID Term name Evidence Residue Reference Count
SO:0000418
ECO:0000256 1-22 UniProt Consortium (2023) 226
Protein properties
Molecular weight 23.43 kDa
Number of residues 209
Average residue weight 112 Da
Charge at pH 7 -7.95
Isoelectric point 4.27
Protein sequence feature
  Term ID Term name Evidence Residue Reference Count
SO:0000418
ECO:0000256 1-22 UniProt Consortium (2023) 226
Orthologs
Manually assigned orthologs
Ortholog species Ortholog gene Ortholog description Reference
Schizosaccharomyces pombe SPAC977.05c Velum formation protein 1-like conserved fungal family Herrero J et al. (2016)
Schizosaccharomyces pombe SPBC1348.06c Velum formation protein 1-like conserved fungal family Herrero J et al. (2016)
Schizosaccharomyces pombe SPBPB2B2.15 Velum formation protein 1-like conserved fungal family Rhind N et al. (2011)
Saccharomyces cerevisiae VEL1 (YGL258W) Protein of unknown function more ... Lock A et al. (2018)
Saccharomyces cerevisiae VEL1 (YGL258W) Protein of unknown function more ... Lock A et al. (2018)
Saccharomyces cerevisiae VEL1 (YGL258W) Protein of unknown function more ... Lock A et al. (2018)
Saccharomyces cerevisiae VEL1 (YGL258W) Protein of unknown function more ... Herrero J et al. (2016)
Saccharomyces cerevisiae YOR387C Putative protein of unknown function more ... Lock A et al. (2018)
Saccharomyces cerevisiae YOR387C Putative protein of unknown function more ... Lock A et al. (2018)
Saccharomyces cerevisiae YOR387C Putative protein of unknown function more ... Lock A et al. (2018)
Saccharomyces cerevisiae YOR387C Putative protein of unknown function more ... Herrero J et al. (2016)
Ortholog prediction resources
Ensembl Fungal Compara SJAG_00161 Alignments, gene trees, orthologs, families
Ensembl Pan-taxonomic Compara SJAG_00161 Gene tree, orthologs
Transcript details
Key:
 
UTR
 
exon
mRNA SJAG_00161.1
Velum formation protein 1-like conserved fungal family
Location: 3921875-3921246 (630nt), chromosome I reverse strand     Product size: 209 aa, 23.43 kDa
 
Sequence
Manually select residues
>SJAG_00161.1 length:209
MNFFYTLLAFIQTFVVLNGVSALRFDLTNVTCSRLRGPRCGTYLLRVAGTNATFLGQKYLVGFEALTQPKEDFLKRYLENEPRLIPRLTTVAENQTDSFHPFFFTTNQASCNPQSIESDLIPFVNTVTNEIQYDSWAYTMLNASLINGLANQLMNASTYGVQVATCLPGFTNGYFDAPTVNIFNNDEEVPSWCTAIEFEAVCPLDVGFN*
External references
GO annotation QuickGO B6JXM1 QuickGO Gene Ontology annotation viewer
GO annotation AmiGO SJAG_00161 GO Consortium browser
Interactions STRING B6JXM1 Network display of known and predicted interactions and functional associations
Sequence Resources UniProtKB/SwissProt B6JXM1 Protein database
Sequence Resources NCBI SJAG_00161 Query all NCBI databases
Sequence Resources Ensembl SJAG_00161 Genome browser
Orthologs Ensembl Fungal Compara SJAG_00161 Alignments, gene trees, orthologs, families
Orthologs Ensembl Pan-taxonomic Compara SJAG_00161 Gene tree, orthologs
Literature
Search PubMed for SJAG_00161
Sort by: Publication gene count | Authors | Year: Ascending / Descending
Details Genes
UniProt: the Universal Protein Knowledgebase in 2023.
UniProt Consortium Nucleic Acids Res 2023 Jan 06;51(D1):D523-D531 PMID:36408920 details ...
271
Ensembl comparative genomics resources.
Herrero J et al. Database (Oxford) 2016;2016 PMID:26896847 details ...
2644
PomBase: The Scientific Resource for Fission Yeast.
Lock A et al. Methods Mol Biol 2018;1757:49-68 PMID:29761456 details ...
4165
Comparative functional genomics of the fission yeasts.
Rhind N et al. Science 2011 May 20;332(6032):930-6 PMID:21511999 details ...
4284